Каталог одежды Бонприкс. Действующий каталог Bonprix в удобном формате для просмотра. Все актуальные и новые каталоги Бонприкс в одном месте и в отличном качестве.

2.25 Rating by CuteStat

bonprix-catalog.ru is 1 decade 3 years old. It is a domain having ru extension. It has a global traffic rank of #1357840 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, bonprix-catalog.ru is SAFE to browse.

PageSpeed Score
80
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 354
Daily Pageviews: 708

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: 5

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,357,840
Domain Authority: 25 ON 100

Web Server Information

Hosted IP Address:

46.4.95.57

Hosted Country:

Germany DE

Location Latitude:

49.4478

Location Longitude:

11.0683

Domain Information

Domain Registrar: Everest 93, LLC
Registration Date: Oct 27, 2010, 12:00 AM 1 decade 3 years 6 months ago
Expiration Date: Oct 27, 2013, 12:00 AM 1 decade 6 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns1.r01.ru 31.177.80.41 Russia Russia
ns2.r01.ru 89.111.166.6 Russia Russia

Similarly Ranked Websites

My blog | Just another WordPress site

- impresivefunnyxd.com
1,357,841 $ 480.00

Happy Valentines Day Images Happy Valentines day Wishes pics

- happyvalentinesdayimageswishes.com

Happy Valentines Day Images Happy Valentines day Wishes Valentin's Day Images Valentine's day wishes Happy valentines day Pictures Rose day Images And

1,357,841 $ 480.00

Ariel Atom Chat

- arielatomchat.com

Worldwide Ariel Atom discussion forum for all Ariel Atom owners and enthusiasts. Technical discussion, marketplace, photos, videos, parts, and more.

1,357,842 $ 960.00

Suspended

- buxunite.com

Association sans but lucratif regroupant les enseignantes et enseignants des collèges du Québec enseignant les techniques d'éducation à l'enfance.

1,357,844 $ 480.00

Homeless Programs & Services | Homeless Shelters | Midnight Mission |

- midnightmission.org

The Midnight Mission has been helping people experiencing homelessness transform their lives since 1914, learn more & get involved today!

1,357,845 $ 8.95